PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G237500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 377aa    MW: 39748.5 Da    PI: 6.4466
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G237500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.73e-09195253563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         k+++r + NR +A rs +RK  +i+eLe+kv+ ++ e ++L+ +l  l+   a l++e+
  Sevir.6G237500.1.p 195 KKAKRIINNRQSAARSKERKMRYIAELERKVQFMQREATTLATQLALLQRDTAGLTAEN 253
                         89**********************************************99998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-14191255IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.461193256IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.5E-10195249No hitNo description
PfamPF001701.1E-7195249IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.59E-10195247No hitNo description
CDDcd147039.87E-23196247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MNMDTTPIAG GGGGGGDAEG GGGCAAGNVP AMQSSCDAVA PSPAPHTECD MSRMPDSPVR  60
KPGHRRALSD IIGLPNDLDL GAPGAGDGPA LSEENEEELF SMFLDVEKLN SRCGASESES  120
SCAMAGGGGE ATQMSAAPGA GLRPRHHQRH SMDASSSIDA ENLFGTSAMN GVSPVEAKKA  180
MSAAKLAELA LIDPKKAKRI INNRQSAARS KERKMRYIAE LERKVQFMQR EATTLATQLA  240
LLQRDTAGLT AENGELKLRL QNTEHQVHLQ DALNDALKSE LQRLKMATGQ MGSGGGAMNF  300
GASPHPFGSN HHHQQMFHPN QAMPPPFAAM QQQQLLPNQP LHPLQTQQAA INLNMKGPAP  360
APNQWWGDAW SESSSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974066.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ69IL41e-107RF2A_ORYSJ; Transcription factor RF2a
TrEMBLK3YMV40.0K3YMV4_SETIT; Uncharacterized protein
STRINGSi015587m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.15e-68bZIP family protein